PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00071.203
Common NameAMTR_s00071p00193200, LOC18448466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25650 Da    PI: 9.5468
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00071.203genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.7e-31958150
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                              krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++yey+
  evm_27.model.AmTr_v1.0_scaffold00071.203  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYA 58
                                              79***********************************************8 PP

2K-box1141.5e-37751732100
                                     K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                                               ++ss +s +ea+++++qqe++kL+++i+ Lq+ +Rh++G++L+ L++keL+qLe +Le++l++iRskKn
  evm_27.model.AmTr_v1.0_scaffold00071.203  75 DSSSATSISEANSQYYQQEATKLRQQIQLLQNANRHFMGDGLSALTIKELKQLEGRLERGLTRIRSKKN 143
                                               56778889************************************************************* PP

                                     K-box  71 ellleqieelqkkekelqeenkaLrkklee 100
                                               ell+++ie++q+ke elq++n++Lr+k++e
  evm_27.model.AmTr_v1.0_scaffold00071.203 144 ELLFAEIEYMQNKEAELQKDNMYLRAKIAE 173
                                               ***************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.964161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-33275IPR002100Transcription factor, MADS-box
CDDcd002654.98E-44271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003199.8E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-2984171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.77887177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEYANN  60
NIKTTIERYK KASADSSSAT SISEANSQYY QQEATKLRQQ IQLLQNANRH FMGDGLSALT  120
IKELKQLEGR LERGLTRIRS KKNELLFAEI EYMQNKEAEL QKDNMYLRAK IAEQDRTQQS  180
NMLPAPEFDA IPTFDSQNYY QVNLMEGAHH YRNQDQTALH LG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-22180180Myocyte-specific enhancer factor 2B
1tqe_Q6e-22180180Myocyte-specific enhancer factor 2B
1tqe_R6e-22180180Myocyte-specific enhancer factor 2B
1tqe_S6e-22180180Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006858589.11e-165PREDICTED: floral homeotic protein AGAMOUS
SwissprotQ408851e-108AG_PETHY; Floral homeotic protein AGAMOUS
TrEMBLU5D3A61e-165U5D3A6_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr5P16870_0011e-121(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-96MIKC_MADS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]